« Zurück
Startseite /
Recombinant Human Galectin-9/LGALS9 Protein

Recombinant Human Galectin-9/LGALS9 Protein

ArtNr	RP01046-20ug
Hersteller	Abclonal
Menge	20 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 500 ug 50 ug 5 ug
Kategorie	Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion
Typ	Proteins
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 92% by SDS-PAGE.
NCBI	Galectin-9/LGALS9
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	LGALS9,HUAT,LGALS9A
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	Please contact us for more information.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	36.59 kDa
Description	Recombinant Human Galectin-9/LGALS9 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala2-Thr323) of human Galectin-9/LGALS9 (Accession #NP_002299.2) fused with a 6×His tag at the N-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala2-Thr323
Route	N-His
Manufacturer - Research Area	Immune Checkpoint
Revised name	Ecalectin, GAL9, gal-9, galectin 9, Galectin9, Galectin-9, HUAT, lectin, galactoside-binding, soluble, 9, LGALS9, LGALS9A, MGC117375, MGC125973, MGC125974, Tumor antigen HOM-HD-21, urate transporter/channel protein
Antigen Seq	AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
Bioactivity	1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Galectin-9 at 2 μg/mL can bind Recombinant Human TIM-3 with a linear range of 5-15 μg/mL.\|2. Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. When 8×10⁴ cells/well are added to LGALS9 coated plates (5 μg/mL and 100 μL/well) in the ppresence of 10μg/ml PHA, approximately 70-80% cells will adhere specifically after 60 minutes at 37°C.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	36.59 kDa
Gene Symbol	Galectin-9/LGALS9

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01046-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern