« Zurück
Startseite /
Recombinant SARS-CoV-2 Spike S1 Protein

Recombinant SARS-CoV-2 Spike S1 Protein

ArtNr	RP01262-10ug
Hersteller	Abclonal
Menge	10 ug
Quantity options	1000 ug 100 ug 10 ug 1 mg
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	SARS-CoV-2
Host	SARS-CoV-Infected Cells
Purity	>90% by SDS-PAGE;> 95% by HPLC
NCBI	SARS-CoV-2 Spike S1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Envelope,SARS-CoV-2 Spike RBD (N501Y),Spike,Spike ECD,Spike RBD,Spike S1,Spike S2,Spike S2 ECD,S1-RBD protein,NCP-CoV RBD Protein,novel coronavirus RBD Protein,2019-nCoV RBD Protein,S glycoprotein Subunit1 RBD Protein
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	75.85 kDa
Description	Recombinant SARS-CoV-2(2019-nCoV) Spike S1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Val16-Arg685) of SARS-COV-2(2019-nCoV) Spike S1 (Accession #YP_009724390.1) fused with a 6×His tag at the C-terminus.
Background	The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates thisinteraction.The S protein plays key parts in the induction of neutralizing-antibody and T-cellresponses, as well as protective immunity.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Val16-Arg685
Route	C-His
Manufacturer - Research Area	SARS-CoV-2 antigens
Revised name	S1 protein, Spike glycoprotein Subunit1, S glycoprotein Subunit1, Spike protein S1, novel coronavirus s1 Protein
Antigen Seq	VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
Bioactivity	1. Measured by its binding ability in a functional ELISA. Immobilized Recombinant SARS-CoV-2 Spike S1 at 2 μg/mL (100 μL/well) can bind Recombinant Human ACE2 with a linear range of 0. 5-8. 7 ng/mL.\|2. Immobilized Human ACE2 on COOH Chip can bind SARS-COV-2 Spike S1 with an affinity constant of 11. 4 nM as determined in a SPR assay (Nicoya OpenSPR).
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. or Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	75.85 kDa
Gene Symbol	SARS-CoV-2 Spike S1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01262-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern