« Zurück
Startseite /
Recombinant Human CCL3/MIP-1 alpha Protein

Recombinant Human CCL3/MIP-1 alpha Protein

ArtNr	RP01636-10ug
Hersteller	Abclonal
Menge	10 ug
Quantity options	10 ug 20 ug 50 ug
Kategorie	Oncology By Cell Type Carcinoma Hematology Lymphoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Autophagy
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE.
Sequence	ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
NCBI	CCL3/MIP-1 alpha
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	MIP1A,SCYA3,G0S19-1,LD78ALPHA,MIP-1-alpha,CCL3
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	＜1EU/μg
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	7.79 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human CCL3/MIP-1 alpha Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala23-Ala92) of human CCL3/MIP-1 alpha (Accession #NP_002974.1) fused with no additional amino acid.
Background	Monokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala23-Ala92
Route	NO-tag
Endotoxin	＜1EU/μg
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	ASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size	7.79 kDa
Gene Symbol	CCL3/MIP-1 alpha

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01636-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern