Vergleich

PB1 (BD4), Recombinant, Human, aa528-618, His-Tag (PBRM1, BRG1-Associated Factor 180, Variant 2, Polybromo 1)

ArtNr USB-298440
Hersteller United States Biological
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Format Liquid
Specific against other
Konjugat/Tag HIS
Purity Purified (~75%)
Dry ice Yes
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Versandbedingung Trockeneis
Lieferbar
Manufacturer - Category
Molecular Biology / MB-Transcription Factors
Shipping Temperature
Dry Ice
Storage Conditions
-70°C
Molecular Weight
11, 7
Grade
Purified
Form
Supplied as a liquid in 50mM Tris-HCl, pH 8.0, 150mM sodium chloride, 10% glycerol.
EU Commodity Code
30021019
Description
This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma. [provided by RefSeq, Feb 2012].

Source:
Recombinant protein corresponding to bromodomain 4, aa528-618, from human polybromo 1, fused to His-tag at N-terminal, expressed in E. coli.

Molecular Weight:
~11.7kD

AA Sequence:
MHHHHHHNVVLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRND
KYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLL

Applications:
Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Shelf Life
1 year

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 22.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen