PB1 (BD4), Recombinant, Human, aa528-618, His-Tag (PBRM1, BRG1-Associated Factor 180, Variant 2, Polybromo 1)

Dry Ice

11, 7

Supplied as a liquid in 50mM Tris-HCl, pH 8.0, 150mM sodium chloride, 10% glycerol.

This locus encodes a subunit of ATP-dependent chromatin-remodeling complexes. The encoded protein has been identified as in integral component of complexes necessary for ligand-dependent transcriptional activation by nuclear hormone receptors. Mutations at this locus have been associated with primary clear cell renal cell carcinoma. [provided by RefSeq, Feb 2012].

Source:
Recombinant protein corresponding to bromodomain 4, aa528-618, from human polybromo 1, fused to His-tag at N-terminal, expressed in E. coli.

Molecular Weight:
~11.7kD

AA Sequence:
MHHHHHHNVVLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRND
KYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLL

Applications:
Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.