Mouse Anti-Human S100P

ArtNr	101-11512
Hersteller	Raybiotech
Menge	100 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Melanoma Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining Cytoskeleton Markers
Typ	Antibody Monoclonal
Applikationen	WB, IF, ELISA
Specific against	Human (Homo sapiens)
Host	Hamster - Armenian
Isotype	IgG2b Kappa
Sequence	MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKE LPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAA ITSACHKYFEKAGLK
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	S100P
Lieferbar
Storage Conditions	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Gene Symbols	S100P
Protein Name & Synonyms	S100P
Format	In 1x PBS, pH 7.2
Manufacturer - Specificity	Human
Buffers	1x PBS, pH 7.2
Expiration	12 months from the date of shipment when stored properly.
Clonality	Monoclonal

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.