« Back
Home /
Mouse Anti-Human S100P

Mouse Anti-Human S100P

Item no.	101-11512
Manufacturer	Raybiotech
Amount	100 ug
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Targets for Rodent Neurosciences Antibodies By Cell Type Melanoma Western Blot ELISA Immunofluorescence Primary Antibodies Immunostaining Cytoskeleton Markers
Type	Antibody Monoclonal
Applications	WB, IF, ELISA
Specific against	Human (Homo sapiens)
Host	Hamster - Armenian
Isotype	IgG2b Kappa
Sequence	MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKE LPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAA ITSACHKYFEKAGLK
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	S100P
Available
Storage Conditions	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Gene Symbols	S100P
Protein Name & Synonyms	S100P
Format	In 1x PBS, pH 7.2
Manufacturer - Specificity	Human
Buffers	1x PBS, pH 7.2
Expiration	12 months from the date of shipment when stored properly.
Clonality	Monoclonal

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.