« Zurück
Startseite /
Anti-Growth Hormone Polyclonal Antibody

Anti-Growth Hormone Polyclonal Antibody

ArtNr	128-10223-3
Hersteller	Raybiotech
Menge	100 ug
Quantity options	5 ug 20 ug 100 ug
Kategorie	Metabolism Diabetes Antibodies Western Blot ELISA Primary Antibodies Immunostaining
Typ	Antibody
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Purity	Greater than 98%.
Sequence	FPTI PLSRLFDNAM LRAHRLHQLAFDTYQ ,EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNRE ETQQKSNLE ,LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL KDLEEGIQTLMGRLE DGSPRTGQIFKQ TYSK DTNSHNDDALLKNYGLLYCFRK DM DKVETFLRIVQCRSVEGSCGF
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Similar products	Growth
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Applications	ELISA: to detect HGH by indirect ELISA, a dilution of at least 1/1, 000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng/well of HGH. Western Blot: to detect HGH by Western Blotting analysis this antibody can be used in a dilution of 1/1, 500.
Manufacturer - Category	Antibodies\|Primary Antibodies
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
UNSPSC Code	12352203
Formulation	Lyophilized from a sterile filtered (0.2µm) solution containing phosphate buffered saline.
Protein Name & Synonyms	Growth Hormone Polyclonal
Purification	Purified IgG prepared by affinity chromatography on protein G.
Expiration	12 months from the date of shipment when stored properly.
Clonality	Polyclonal
Immunogen	IgG Anti HGH has been developed in rabbit using highly pure (>98%) recombinant human HGH expressed in plants.
Solubility	Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.