« Zurück
Home /
Mouse anti-Glypican-3 (511~560aa) (9A6-B4-G1)

Mouse anti-Glypican-3 (511~560aa) (9A6-B4-G1)

Hersteller	Raybiotech
Kategorie	Oncology Neuroscience Neural Signaling Antibodies By Cell Type Blastoma Carcinoma Primary Antibodies
Typ	Antibody
Specific against	Human
Clon	9A6-B4-G1
Applikationen	ELISA
Menge	500 ug
Host	Hamster - Armenian
ArtNr	131-0067-500
Targets	GPC1;;GPC3
eClass 6.1	32160702
eClass 9.0	32160702
Lieferbar
Application Information	ELISA (recommended work dilution = 1:320, 000)
Protein Name & Synonyms	Glypican-3 (511~560aa)
Reconstitution	Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml.
Expiration	12 months from the date of shipment when stored properly.
Clonality	Monoclonal
Preparation	Immunogen was polypeptide Glypican-3 (511~560aa)-KLH:DGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHS. This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with the immunogen. The IgG fraction of tissue culture supernatant was purified by Protein G/A affinity chromatography.
Western Blot	10% SDS-PAGE, Goat anti-mouse HRP: 1:5000.Lane:M: protein marker1: HepG2 cell lysate (10 µl)2: Hela cell lysate (10 µl)3: Mouse Liver lysate (10 µl)StorageThe antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 23.05.2024

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern