« Zurück
Home /
Otoraplin, Human Recombinant

Otoraplin, Human Recombinant

ArtNr	228-20211-3
Hersteller	Raybiotech
Menge	1 mg
Quantity options	20 ug 1 mg
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Bladder Cancer
Typ	Proteins
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	Greater than 98.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Proteins and Peptides\|Recombinant Proteins
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	The OTOR protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH -7.4 and 130mM NaCl.
Expressed Region	VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE.
Protein Name & Synonyms	Otoraplin, Fibrocyte-derived protein, Melanoma inhibitory activity-like protein, OTOR, MIAL, FDP, MIAL1, MGC126737, MGC126739.
UNSPSC Code	12352202

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

228-20211-3.pdf

228-20211-3-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 31.07.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail