« Zurück
Startseite /
Recombinant Human DEFENSIN BETA 2

Recombinant Human DEFENSIN BETA 2

ArtNr	DS-01-0084
Hersteller	Raybiotech
Menge	20 ug
Kategorie	Peptides & Proteins Recombinant Proteins Western Blot ELISA Immunostaining Functional Assays
Typ	Proteins Recombinant
Format	Lyophilized
Applikationen	WB, ELISA, FA
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	>98% by SDS PAGE and HPLC analysis.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	Defensin beta
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Applications	ELISA (0.2-0.4ng/well), Functional Assays (10-100ng/ml), Western Blotting (1.5-3.0ng/lane), ELISA (0.2-0.4ng/well), Functional Assays (10-100ng/ml), Western Blotting (1.5-3.0ng/lane)
Manufacturer - Category	Proteins\|Recombinant Proteins\|Human Proteins
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
Molecular Weight	4.3kD (41 amino acid sequence/residues)
Description	Purified recombinant BD-2, expressed in E. coli
UNSPSC Code	12352202
Expressed Region	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Protein Name & Synonyms	DEFENSIN BETA 2,
Manufacturer - Format	Purified recombinant protein - lyophilized
Concentration	~0.1mg/ml after reconstitution
Endotoxin Level	<0.1ng/ug
Preservative	None present
Biological activity	Determined by its ability to chemoattract immature dendritic cells using a concentration of 10.0-100.0 ng/ml.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

DS-01-0084.pdf

DS-01-0084-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 22.01.2026

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern