« Back
Home /
Recombinant Human DEFENSIN BETA 2

Recombinant Human DEFENSIN BETA 2

Item no.	DS-01-0084
Manufacturer	Raybiotech
Amount	20 ug
Category	Peptides & Proteins Recombinant Proteins Western Blot ELISA Immunostaining Functional Assays
Type	Proteins Recombinant
Format	Lyophilized
Applications	WB, ELISA, FA
Specific against	Human (Homo sapiens)
Host	E.coli
Purity	>98% by SDS PAGE and HPLC analysis.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	Defensin beta
Shipping Condition	Room temperature
Available
Manufacturer - Applications	ELISA (0.2-0.4ng/well), Functional Assays (10-100ng/ml), Western Blotting (1.5-3.0ng/lane), ELISA (0.2-0.4ng/well), Functional Assays (10-100ng/ml), Western Blotting (1.5-3.0ng/lane)
Manufacturer - Category	Proteins\|Recombinant Proteins\|Human Proteins
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
Molecular Weight	4.3kD (41 amino acid sequence/residues)
Description	Purified recombinant BD-2, expressed in E. coli
UNSPSC Code	12352202
Expressed Region	GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Protein Name & Synonyms	DEFENSIN BETA 2,
Manufacturer - Format	Purified recombinant protein - lyophilized
Concentration	~0.1mg/ml after reconstitution
Endotoxin Level	<0.1ng/ug
Preservative	None present
Biological activity	Determined by its ability to chemoattract immature dendritic cells using a concentration of 10.0-100.0 ng/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

DS-01-0084.pdf

DS-01-0084-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 1/22/2026

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer