« Zurück
Startseite /
Ciliary Neurotrophic Factor, Rat Recombinant

Ciliary Neurotrophic Factor, Rat Recombinant

ArtNr	228-10261-3
Hersteller	Raybiotech
Menge	1 mg
Quantity options	25 ug 1 mg
Kategorie	Neuroscience Metabolism Diabetes Glucose Homeostasis Regulation of Appetite Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Rat (Rattus norvegicus)
Host	E.coli
Purity	Greater than 99.0% as determined by:(a) Analysis by Gel Filtration.(b) Analysis by SDS-PAGE.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	CNTF
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Proteins\|Recombinant Proteins\|Animal Proteins
Shipping Temperature	Ambient temperature
Storage Conditions	-20°C
UNSPSC Code	12352202
Formulation	Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3.
Expressed Region	AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.
Protein Name & Synonyms	HCNTF, CNTF, Ciliary Neurotrophic Factor.
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Biological activity	Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

228-10261-3.pdf

228-10261-3-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 04.12.2025