Vergleich

Interleukin-1 beta, Rat Recombinant

ArtNr 228-10849-3
Hersteller Raybiotech
Menge 1 mg
Quantity options 10 ug 1 mg
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Rat (Rattus norvegicus)
Host E.coli
Purity Greater than 97.0% as determined by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Similar products IL-1 beta
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Category
Proteins|Recombinant Proteins|Animal Proteins
Shipping Temperature
Ambient temperature
Storage Conditions
-20°C
UNSPSC Code
12352202
Formulation
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4.
Expressed Region
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
Protein Name & Synonyms
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Format
Sterile Filtered White lyophilized (freeze-dried) powder.
Biological activity
The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10, 000, 000 units/mg.
Protein Content
Protein quantitation was carried out by two independent methods:1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics). 2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen