Vergleich

human BDNF-Biotin Europäischer Partner

ArtNr ALO-B-250-B-10ug
Hersteller Alomone
Menge 10 ug
Quantity options 10 ug 10 x 10 ug 2 ug 2 x 10 ug 5 ug 5 x 10 ug 5 x 2 ug
Kategorie
Typ Molecules
Format Lyophilized
Applikationen WB, IF
Specific against other
Konjugat/Tag Biotin
Formula Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Sequence HSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR-OH
ECLASS 10.1 32169090
ECLASS 11.0 32169090
UNSPSC 12000000
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Type
Non Antibodies
Manufacturer - Applications
Western blot, Fluorescence staining, Live cell imaging, Immunofluorescence
Manufacturer - Category
Proteins
Manufacturer - Targets
p75NTR, TrkB receptors
Manufacturer - Conjugate / Tag
Sulfo-NHS-LC-Biotin (~556 Da) was used for labeling human BDNF. The extent of labeling is 1-2 molecules of biotin per one molecule of human BDNF. The biotin is covalently conjugated to the N-terminus or to lysine residues present in human BDNF.
Country of Origin
Israel
Shipping Temperature
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Storage Conditions
Storage as Solution: Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. - Storage before Reconstitution: The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture. - Storage after Reconstitution: Store the reconstituted solution for the shortest time possible at -20°C. We do not recommend storing the product in working solution for longer than one day. Avoid multiple freeze-thaw cycles.
Molecular Weight
~28 kDa (dimer)
Manufacturer - Format
Lyophilized
Short description
Biotin Labeled human BDNF for Qdot Labeling
Description
Brain-Derived Neurotrophic Factor - Biotin Labeled human BDNF for Qdot Labeling
Reconstitution
Centrifuge the vial (10, 000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Specificity

Biotin Labeled human BDNF for Qdot Labeling

PH
7, 4
UNSPSC
12352202
Modifications
LC-Biotin
Effective Concentration
ED50 = 220 pM
Activity
BDNF is a neurotrophic factor and binds p75NTR as well as TrkB receptors1, 2.
Solubility
Centrifuge the vial before adding solvent (10, 000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (50 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in sterile water at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Sterile endotoxin free
no
Bioassay tested
yes
Scientific Background
Few examples in the literature emphasize the importance of using BDNF-biotin in living cells experiments. Pardridge, W.M et al. demonstrated that the delivery of BDNF to the brain is non-existent owing to the combined effects of neglible blood brain barrier (BBB) transport and rapid systemic clearance1. The brain delivery of BDNF may be increased by conjugating biotinylated BDNF to BBB drug delivery vectors, such as neutral avidin conjugated to murine monoclonal antibody to the rat transferrin receptor1. Zhang, Y. and Pardridge, W.M further showed that when BDNF is formulated to enable transport across the BBB, the intravenous administration of BDNF results in the reduction in stroke volume and improvement in functional outcome2.Du, J. et al. detected by using BDNF-biotin the ligand-induced TrkB internalization in cultured hippocampal neurons3.Bhattacharyya, A. et al. showed in mature sciatic nerves, that biotinylated BDNF activated Trk receptors function as rapid retrograde signal carriers to execute remote responses to target-derived neurotrophins4.Song, X.Y. et al. proved that exogenous BDNF-biotin is transported by the peripheral nerves following injection into the rat footpad and can be found in the sciatic nerves in fibres and vesicles5. Their data suggest that peripherally applied BDNF may have therapeutic effects on injured spinal cord. Xie, W. et al. followed the trafficking of QD-BDNF (Quantum Dot-BDNF) after its internalization at the axon terminal6. Their result showed that QD-BDNF could be used to track the movement of exogenous BDNF in neurons over long distances and to study the signaling organelles that contain BDNF6.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 08.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen