PTHrP

ArtNr	RLT-100-275S
Hersteller	ReliaTech
Menge	10ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Thyroid Cancer
Typ	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	Parathyroid Hormone-related Protein
Lieferbar
NCBI Gene ID	5744
Uniprot	P12272
Biological Activity	Data not available.
Description	PTHrP is a polypeptide hormone produced by almost every tissue of the body. PTHrP is closely related to parathyroid hormone (PTH), which is secreted from the parathyroid gland, and plays a central role in regulating the extracellular concentrations of calcium and phosphorous. Recombinant human PTHrP is a 9.8 kDa linear polypeptide of 86 amino acid residues.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	86
Molecular Weight	9.8 kDa
mRNA RefSeq	NM_002820.2
Protein RefSeq	NP_002811.1
Protein Sequence	AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP
Purity Confirmation	> 98% by SDS-PAGE & HPLC analyses
Synonyms	Parathyroid Hormone-related Protein
Uniprot ID	P12272

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10ug

lieferbar

Lieferung vsl. bis 21.08.2025

Express-Lieferung: 21 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern