Vergleich

FGF-2 (basic) Europäischer Partner

ArtNr RLT-M30-015
Hersteller ReliaTech
Menge 50ug
Kategorie
Typ Cytokines and Growth Factors
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Fgf2, Fgfb, bFGF, Fgf-2
Lieferbar
NCBI Gene ID
14173
Uniprot
P15655
Biological Activity
The ED50 for stimulation of cell proliferation by human umbilical vein endothelial cells for mouse FGF-2 has been determined to be in the range of 0.1-2 ng/ml.
Buffer
PBS
Description
FGF basic (FGF2, HBGF2) is one of at least 23 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation (1-3). Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted (4). Transcription from alternate start sites produces 21-24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH3T3 cells (5). The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine and sheep FGF basic (6, 7). Autocrine, intracrine and paracrine actions of FGF basic have been identified. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity (3). Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis reminiscent of a variety of pathological conditions (1-3).
Endotoxin Levels
< 0.1 ng per µg of mouse FGF-2
Length [aa]
144
Molecular Weight
16.35 kDa
mRNA RefSeq
NM_008006.2
N Terminal Sequence
ALPEDDGG
Protein RefSeq
NP_032032.1
Protein Sequence
ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity Confirmation
> 98% by SDS-PAGE & visualized by silver stain
Reconstitution
The lyophilized basic FGF should be reconstituted in water containing at least 0.1% human or bovine serum albumin to a concentration not lower than 10µg/ml.
Stability And Storage
Lyophilized samples are stable for greater than six months at -20 °C to -70 °C. Basic FGF can be stored in high-salt buffer (PBS, 1M NaCl) at 4 °C for 2-4 weeks.
Synonyms
Fgf2; Fgfb; bFGF; Fgf-2
Uniprot ID
P15655

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen