Comparison

FGF-2 (basic) European Partner

Item no. RLT-M30-015
Manufacturer ReliaTech
Amount 50ug
Category
Type Cytokines and Growth Factors
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Fgf2, Fgfb, bFGF, Fgf-2
Available
NCBI Gene ID
14173
Uniprot
P15655
Biological Activity
The ED50 for stimulation of cell proliferation by human umbilical vein endothelial cells for mouse FGF-2 has been determined to be in the range of 0.1-2 ng/ml.
Buffer
PBS
Description
FGF basic (FGF2, HBGF2) is one of at least 23 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation (1-3). Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. Storage pools within the cell or on cell surface heparan sulfate proteoglycans (HSPG) are likely. The predicted 17 kDa FGF basic isoform can be located in both the cytoplasm and the nucleus and is presumed to be the form secreted (4). Transcription from alternate start sites produces 21-24 kDa forms found only in the nucleus. High and low molecular weight human FGF basic targets the expression of different genes when expressed in NIH3T3 cells (5). The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine and sheep FGF basic (6, 7). Autocrine, intracrine and paracrine actions of FGF basic have been identified. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity (3). Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis reminiscent of a variety of pathological conditions (1-3).
Endotoxin Levels
< 0.1 ng per µg of mouse FGF-2
Length [aa]
144
Molecular Weight
16.35 kDa
mRNA RefSeq
NM_008006.2
N Terminal Sequence
ALPEDDGG
Protein RefSeq
NP_032032.1
Protein Sequence
ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity Confirmation
> 98% by SDS-PAGE & visualized by silver stain
Reconstitution
The lyophilized basic FGF should be reconstituted in water containing at least 0.1% human or bovine serum albumin to a concentration not lower than 10µg/ml.
Stability And Storage
Lyophilized samples are stable for greater than six months at -20 °C to -70 °C. Basic FGF can be stored in high-salt buffer (PBS, 1M NaCl) at 4 °C for 2-4 weeks.
Synonyms
Fgf2; Fgfb; bFGF; Fgf-2
Uniprot ID
P15655

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close