« Zurück
Startseite /
Recombinant Human FABP1/L-FABP Protein

Recombinant Human FABP1/L-FABP Protein

ArtNr	RP00501-100ug
Hersteller	Abclonal
Menge	100 ug
Quantity options	1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Specific against	Human (Homo sapiens)
Purity	> 97% by SDS-PAGE.
NCBI	FABP1/L-FABP
Alias	FABP1,FABPL,L-FABP,L-FABP
Lieferbar
Manufacturer - Applications	< 0.01 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	14.92 kDa
Description	Recombinant Human FABP1/L-FABP Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser2-Ile127) of human FABP1/L-FABP (Accession #P07148) fused with a His tag at the N-terminus.
Background	Human Fatty Acid-Binding Protein 1 (FABP1) is a cytoplasm protein, which belongs to the calycin superfamilyand Fatty-acid binding protein (FABP) family. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP1 forms a beta-barrel structure that accommodateshydrophobic ligands in its interior. FABP1 can bind free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm, so it can be involved in intracellular lipid transport.
Manufacturer - Cross Reactivity	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ser2-Ile127
Recommended Dilution	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Route	N-His
Manufacturer - Research Area	Other Recombinant Protein
Antigen Seq	SFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	14.92 kDa
Gene Symbol	FABP1/L-FABP

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00501-100ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 28.08.2025

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern