Vergleich

Recombinant Human/Mouse/Rat mature TGF-beta 3 Protein Europäischer Partner

ArtNr RP00645-100ug
Hersteller Abclonal
Menge 100 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE.
NCBI TGF-beta 3
Alias TGFB3,ARVD,ARVD1,LDS5,RNHF,TGF-beta3
Lieferbar
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
12.70 kDa
Description
Recombinant Human/Mouse/Rat TGF-beta 3 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Ala301-Ser412(Tyr340Phe)) of human TGF-beta 3/TGFB3 (Accession #P10600).
Background
Transforming growth factor beta 3(TGFB3) is a member of a TGF - β superfamily which is defined bytheirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form ofTGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subsetofintegrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involvedincell differentiation, embryogenesis and development.It is believed to regulate molecules involved incellularadhesion and extracellular matrix (ECM) formation during the process of palate development. WithoutTGF-β3, mammals develop a deformity known as a cleft palate.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Ala301-Ser412(Y340F)
Route
No tag
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
Bioactivity
Measured by its ability to inhibit the IL-4-dependent proliferation of HT-2 mouse T cells. The ED50 for this effect is 24. 2-96. 6 pg/mL, corresponding to a specific activity of 1. 04×107~4. 17×107 units/mg.
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of 50mM Glycine-HCl, 150mM NaCl, pH 2.5. Contact us for customized product form or formulation.
Expected Protein Size
12.70 kDa
Gene Symbol
TGF-beta 3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen