Vergleich

Recombinant Mouse IL-21 Protein Europäischer Partner

ArtNr RP00664-100ug
Hersteller Abclonal
Menge 100 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
NCBI IL21
Alias Il21,Interleukin-21,IL-21
Lieferbar
Manufacturer - Applications
<0.1EU/ug of the protein by LAL method.
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
40.79 kDa
Description
Recombinant Mouse IL-21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His18-Ser146) of Mouse IL-21 (Accession #NP_068554.1) fused with a hFc tag at the C-terminus.
Background
Interleukin-21 (IL-21) is an approximately 14 kDa four-helix-bundle cytokine in the family of cytokines that utilize the common gamma chain ( gamma c) as a receptor subunit. gamma c is also a subunit of the receptors for IL-2, IL-4, IL-7, IL-9, and IL-15 . IL-21 is produced by activated T follicular helper cells (Tfh), Th17 cells, and NKT cells. It exerts its biological effects through a heterodimeric receptor complex of gamma c and the IL-21-specific IL-21 R. Tfh-derived IL-21 plays an important role in the development of humoral immunity through its autocrine effects on the Tfh cell and paracrine effects on immunoglobulin affinity maturation, plasma cell differentiation, and B cell memory responses . It is also required for the migration of dendritic cells to draining lymph nodes . IL-21 regulates several aspects of T cell function. It co‑stimulates the activation, proliferation, and survival of CD8+ T cells and NKT cells and promotes Th17 cell polarization . It blocks the generation of regulatory T cells and their suppressive effects on CD4+ T cells. IL-21 R engagement enhances the cytolytic activity and IFN-gamma production of activated NK cells but limits the expansion of resting NK cells . In addition, IL-21 suppresses cutaneous hypersensitivity reactions by limiting allergen-specific IgE production and mast cell degranulation . Dysregulation of the IL‑21/IL‑21 R system contributes to the development of multiple immunological disorders . The mouse IL‑21 precursor contains a predicted 17 amino acid (aa) signal sequence and a 129 aa mature chain. Mature mouse IL-21 shares 66%, 59%, 58%, and 88% aa sequence identity with mature canine, human, rabbit, and rat IL-21, respectively.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
His18-Ser146
Route
C-hFC
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
KSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size
40.79 kDa
Gene Symbol
IL21

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen