« Zurück
Home /
Recombinant Mouse IFNA2/IFN-alpha 2 Protein

Recombinant Mouse IFNA2/IFN-alpha 2 Protein

ArtNr	RP00688-1000ug
Hersteller	Abclonal
Menge	1000 ug
Quantity options	1000 ug 10 ug 500 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95% by SDS-PAGE.
Sequence	CDLPHTYNLRNKRALKVLAQMRRLPFLSCLKDRQDFGFPLEKVDNQQIQKAQAIPVLRDLTQQTLNLFTSKASSAAWNATLLDSFCNDLHQQLNDLQTCLMQQVGVQEPPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSVNLLPRLSEEKE
NCBI	IFNA2/IFN-alpha 2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interferon Alpha-2,IFN-Alpha-2,Interferon Alpha-A,LeIF A,IFNA2
Lieferbar
Manufacturer - Category	Proteins
Storage Conditions	This product is stable at ≤ -70°C for up to 1 year from the date of receipt.\|For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature.
Description	Reconstitute to a concentration of 0.1-0.5 mg/mL in 1X PBS.
Background	At least 23 different variants of Interferon- α are known. The individual proteins have molecular massesbetween 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- α subtypespossess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- α subtypes differ in their sequences at only one or two positions.Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.
Immunogen	Cys24-Glu190
Route	No tag
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Cytokines & Cytokine Receptors
Protein Formulation	Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1000 ug

lieferbar

Lieferung vsl. bis 05.06.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail