Vergleich

Recombinant Mouse IL-1 R2/IL-1 RII Protein Europäischer Partner

ArtNr RP00726-1000ug
Hersteller Abclonal
Menge 1000 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
NCBI IL-1 RII
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-1 receptor type 2,IL-1R-2,IL-1RT-2,IL-1RT2,CD121 antigen-like family member B,CD121b,IL-1 type II receptor,Interleukin-1 receptor beta,IL-1R-beta,Interleukin-1 receptor typeII,CD121b
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Cytokines & Cytokine Receptors
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Recombinant Mouse IL-1 R2/IL-1 RII Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Phe14-Glu355) of mouse IL-1 R2/IL-1 RII (Accession #P27931) fused with a 6xHis tag at the C-terminus.
Background
Mouse Interleukin 1 receptor, type II (IL1R2) is a cytokine receptor that belongs to the interleukin-1 receptorfamily. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. IL-1R2 structurally consistingof a ligand binding portion comprised of three Ig-like domains, a single transmembrane region, and a shortcytoplasmic domain. It is expressed in a variety of cell types including B lymphocytes, neutrophils, monocytes, large granular leukocytes and endothelial cells. Mouse IL1RII shares 59% amino acid sequence homology withhuman IL1 RII in their extracellular domains. The pleiotropic cytokine IL1 is produced to regulate developmentand maintenance of the inflammatory responses, and binds to specific plasma membrane receptors on cells.Two distinct types of IL1 receptors which are able to bind IL1 specifically have been identified, designated asIL1RI (IL1RA) and IL1RII (IL1RB). IL1R1 contributes to IL-1 signaling, whereas the IL-1R2 has no signalingproperty and acts as a decoy for IL-1.
Manufacturer - Cross Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen
Phe14-Glu355
Recommended Dilution
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Route
C-6xHis
Antigen Seq
FTTPTVVHTGKVSESPITSEKPTVHGDNCQFRGREFKSELRLEGEPVVLRCPLAPHSDISSSSHSFLTWSKLDSSQLIPRDEPRMWVKGNILWILPAVQQDSGTYICTFRNASHCEQMSVELKVFKNTEASLPHVSYLQISALSTTGLLVCPDLKEFISSNADGKIQWYKGAILLDKGNKEFLSAGDPTRLLISNTSMDDAGYYRCVMTFTYNGQEYNITRNIELRVKGTTTEPIPVIISPLETIPASLGSRLIV
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen