Vergleich

Recombinant Mouse IL-1 R1/IL-1 RI Protein Europäischer Partner

ArtNr RP00728-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWND
NCBI IL-1 RI
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-1 receptor type 1,IL-1R-1,IL-1RT-1,IL-1RT1,CD121 antigen-like family member A,Interleukin-1 receptor alpha,IL-1R-alpha,p80,CD121a,mIL-1R1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Cytokines & Cytokine Receptors
Shipping Temperature
ice pack
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturer - Additional Information
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Description
Recombinant Mouse IL-1 R1/IL-1 RI Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Leu20-Lys338) of mouse IL-1 R1/IL-1 RI (Accession #P13504) fused with an Fc tag at the C-terminus.
Background
Mouse Interleukin-1 receptor type 1/IL-1 RI is a cytokine receptor that belongs to the interleukin-1 receptorfamily. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1receptor antagonist (IL1RA). It is an important mediator involved in many cytokine induced immune andinflammatory responses. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor inthe presence of IL1α or IL1β but not IL1ra, was identified. This Type I receptor complex appears to mediate allthe known IL1 biological responses. The receptor Type II has a short cytoplasmic domain and does nottransduce IL1 signals. In addition to the membranebound form of IL1 RII, a naturallyoccurring soluble form ofIL1 RII has been described. It has been suggested that the Type II receptor, either as the membranebound or asthe soluble form, serves as a decoy for IL1 and inhibits IL1 action by blocking the binding of IL1 to the signalingType I receptor complex.
Manufacturer - Cross Reactivity
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Immunogen
Leu20-Lys338
Route
C-Fc
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen