ArtNr |
RP00728-10ug |
Hersteller |
Abclonal
|
Menge |
10 ug |
Quantity options |
1000 ug
10 ug
500 ug
50 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
Purity |
> 95% by SDS-PAGE. |
Sequence |
LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWND |
NCBI |
IL-1 RI |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Interleukin-1 receptor type 1,IL-1R-1,IL-1RT-1,IL-1RT1,CD121 antigen-like family member A,Interleukin-1 receptor alpha,IL-1R-alpha,p80,CD121a,mIL-1R1 |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Manufacturer - Category |
Cytokines & Cytokine Receptors |
Shipping Temperature |
ice pack |
Storage Conditions |
Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week. |
Manufacturer - Additional Information |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Description |
Recombinant Mouse IL-1 R1/IL-1 RI Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Leu20-Lys338) of mouse IL-1 R1/IL-1 RI (Accession #P13504) fused with an Fc tag at the C-terminus. |
Background |
Mouse Interleukin-1 receptor type 1/IL-1 RI is a cytokine receptor that belongs to the interleukin-1 receptorfamily. This protein is a receptor for interleukin 1 alpha (IL1A), interleukin 1 beta (IL1B), and interleukin 1receptor antagonist (IL1RA). It is an important mediator involved in many cytokine induced immune andinflammatory responses. An IL1 receptor accessory protein that can heterodimerize with the Type I receptor inthe presence of IL1α or IL1β but not IL1ra, was identified. This Type I receptor complex appears to mediate allthe known IL1 biological responses. The receptor Type II has a short cytoplasmic domain and does nottransduce IL1 signals. In addition to the membranebound form of IL1 RII, a naturallyoccurring soluble form ofIL1 RII has been described. It has been suggested that the Type II receptor, either as the membranebound or asthe soluble form, serves as a decoy for IL1 and inhibits IL1 action by blocking the binding of IL1 to the signalingType I receptor complex. |
Manufacturer - Cross Reactivity |
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. |
Immunogen |
Leu20-Lys338 |
Route |
C-Fc |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Research Area |
Cytokines & Cytokine Receptors |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.