ArtNr |
RP01347-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Quantity options |
100 ug
10 ug
20 ug
50 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Purity |
> 95% by SDS-PAGE. |
Sequence |
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDC RECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLF QCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN VKGTEDSGTT |
NCBI |
TNFRSF1A/TNF-R1/CD120a |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
TNFRSF1A,CD120a,FPF,TBP1,TNF-R,TNF-R-I,TNF-R55,TNFAR,TNFR1,TNFR55,TNFR60,p55,p55-R,p60 |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Manufacturer - Applications |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
22.08 kDa |
Manufacturer - Additional Information |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Description |
Recombinant Human TNFRSF1A/TNF-R1/CD120a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ile22-Thr211) of human CD120a/TNFRSF1A (Accession #NP_001056.1) fused with 6×His tag at the C-terminus. |
Background |
The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. CD120a (cluste of differentiation 120a), also known as TNFR1 / TNFRSF1A, is a member of CD family, tumor necrosis factor receptor superfamily. CD120a is one of the most primary receptors for the tumor necrosis factor-alpha. It has been shown to be localized to both plasma membrane lipid rafts and the trans golgi complex with the help of the death domain (DD). CD120a can activate the transcription factor NF-κB, mediate apoptosis, and regulate inflammation processes. |
Manufacturer - Cross Reactivity |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Ile22-Thr211 |
Route |
C-His |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Research Area |
TNF family |
Antigen Seq |
IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDC RECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLF QCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN VKGTEDSGTT |
Bioactivity |
1. Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF1A at 2 μg/mL (100 μL/well) can bind Mouse TNFα with a linear range of 4-135 ng/mL.|2. Measured by its ability to inhibit TNFα-mediated cytotoxicity in the L929 mouse fibrosarcoma cells in the presence of metabolic inhibitor actinomycin D. The ED50 for this effect is typically 22-88ng/mL in the presence of 0. 25 ng/mL recombinant human TNFα. |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Expected Protein Size |
22.08 kDa |
Gene Symbol |
TNFRSF1A/TNF-R1/CD120a |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.