ArtNr |
RP01357-100ug |
Hersteller |
Abclonal
|
Menge |
100 ug |
Quantity options |
100 ug
10 ug
20 ug
50 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Purity |
> 90% by SDS-PAGE. |
Sequence |
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
NCBI |
TNFRSF4/OX40/CD134 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
TNFRSF4,ACT35,CD134,IMD16,OX40,TXGP1L |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Manufacturer - Applications |
Please contact us for more information. |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
21.00 kDa |
Manufacturer - Additional Information |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Description |
Recombinant Human TNFRSF4/OX40/CD134 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Ala216) of human OX40/TNFRSF4/CD134 (Accession #NP_003318.1) fused with a 6×His tag at the C-terminus. |
Background |
OX40 (CD134) and its binding partner, OX40L (CD252), are members of the tumor necrosis factor receptor/tumor necrosis factor superfamily, is known to break an existing state of tolerance in malignancies, leading to a reactivation of antitumor immunity. The interaction between OX40 and OX40L plays an important role in antigen-specific T-cell expansion and survival. OX40 and OX40L also regulate cytokine production from T cells, antigen-presenting cells, natural killer cells, and natural killer T cells, and modulate cytokine receptor signaling. In line with these important modulatory functions, OX40-OX40L interactions have been found to play a central role in the development of multiple inflammatory and autoimmune diseases, making them attractive candidates for intervention in the clinic. Conversely, stimulating OX40 has shown it to be a candidate for therapeutic immunization strategies for cancer and infectious disease. |
Manufacturer - Cross Reactivity |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Leu29-Ala216 |
Route |
C-His |
Manufacturer - Research Area |
Immune Checkpoint, Bio-Markers & CD Antigens, TNF family, Biosimilar Drug Targets |
Antigen Seq |
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA |
Bioactivity |
Measured by its binding ability in a functional ELISA. Immobilized Human OX40 at 2 μg/mL (100 μL/well) can bind Human OX40 Ligand/TNFSF4 Protein with a linear range of 156. 25-872. 87 ng/mL. |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Expected Protein Size |
21.00 kDa |
Gene Symbol |
TNFRSF4/OX40/CD134 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.