ArtNr |
RP01371-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Quantity options |
100 ug
10 ug
20 ug
500 ug
50 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Purity |
> 95% by SDS-PAGE. |
Sequence |
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP |
NCBI |
B7-H3/CD276 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
CD276,4Ig-B7-H3,B7-H3,B7H3,B7RP-2,CD276 antigen,4Ig-B7-H3,B7-H3,B7H3,B7RP-2 |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Manufacturer - Applications |
<0.1EU/μg |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
50.00 kDa |
Manufacturer - Additional Information |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Description |
Recombinant Human B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Pro245) of human B7-H3/CD276 (Accession #NP_079516) fused with a Fc, 6×His tag at the C-terminus. |
Background |
B7 homolog 3 (B7-H3), a member of the immunoglobulin superfamily, is also known CD276, which contains two Ig-like C2-type (immunoglobulin-like) domains and two Ig-like V-type (immunoglobulin-like) domains.B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. B7-H3 is a novel protein structurally related to the B7 family of ligands by the presence of a single set of immunoglobulin-V-like and immunoglobulin-C-like (VC) domains. Previous studies have correlated its overexpression with poor prognosis and decreased tumor-infiltrating lymphocytes in various carcinomas including uterine endometrioid carcinomas, and mounting evidence supports an immuno-inhibitory role in ovarian cancer prognosis. Recently, B7-H3 expression has been reported in several human cancers indicating an additional function of B7-H3 as a regulator of antitumor immunity. |
Manufacturer - Cross Reactivity |
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Leu29-Pro245 |
Route |
C-hFc&His |
Endotoxin |
<0.1EU/μg |
Manufacturer - Research Area |
Immune Checkpoint, Bio-Markers & CD Antigens, Biosimilar Drug Targets |
Antigen Seq |
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP |
Bioactivity |
Measured by its binding ability in a functional ELISA. Immobilized Human CD276 at 2μg/mL (100 μL/well) can bind CD276 Rabbit pAb with a linear range of 0. 1-152 ng/mL. |
Protein Formulation |
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. |
Expected Protein Size |
50.00 kDa |
Gene Symbol |
B7-H3/CD276 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.