Vergleich

Recombinant Human CCL5/RANTES Protein Europäischer Partner

ArtNr RP01750LQ-50ug
Hersteller Abclonal
Menge 50 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 97% by SDS-PAGE.
NCBI CCL5/RANTES
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias SISd,eoCP,SCYA5,RANTES,TCP228,D17S136E,SIS-delta
Lieferbar
Manufacturer - Applications
< 1EU/μg
Manufacturer - Category
Proteins
Storage Conditions
Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight
8.69 kDa
Description
Recombinant Human CCL5/RANTES Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ser24-Ser91) of human CCL5/RANTES (Accession #NP_002976.2) fused with and a 6×His tag at the C-terminus.
Background
Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, functions as a chemoattractant for blood monocytes, memory T helper cells and eosinophils. It causes the release of histamine from basophils and activates eosinophils. This cytokine is one of the major HIV-suppressive factors produced by CD8+ cells. It functions as one of the natural ligands for the chemokine receptor chemokine (C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5 strains of HIV-1, which use CCR5 as a coreceptor. Alternative splicing results in multiple transcript variants that encode different isoforms.
Immunogen
Ser24-Ser91
Recommended Dilution
Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Route
C-6His
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CCL5 (Catalog: RP01750LQ) at 5 μg/mL (100 μL/well) can bind Mouse CXCL4 (Catalog: RP03170) with a linear range of 10-252. 6 ng/mL.
Protein Formulation
Supplied as a 0.22 μm filtered solution in PBS, pH 7.4.
Expected Protein Size
8.69 kDa
Gene Symbol
CCL5/RANTES

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen