« Zurück
Startseite /
Recombinant Mouse IFN-beta Protein

Recombinant Mouse IFN-beta Protein

ArtNr	RP01883-20ug
Hersteller	Abclonal
Menge	20 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
NCBI	Ifnb1
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Ifnb1,Ifb,Ifnb,Interferon beta,IFN-beta
Lieferbar
Manufacturer - Applications	<0.1EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	19.73 kDa
Description	Recombinant Mouse IFN-beta Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ile 22 -Asn 182) of Mouse IFN-beta (Accession #NP_034640.1) fused with no tag.
Background	Interferon beta (IFN-beta ), also known as fibroblast IFN, is a secreted, approximately 22 kDa member of the type I interferon family of molecules . Mature mouse IFN-beta shares 75% and 47% amino acid sequence identity with the rat and human proteins, respectively. Fibroblasts are the major producers of IFN-beta, but it can also be produced by dendritic cells, macrophages, and endothelial cells in response to pathogens . It is transcriptionally regulated by TRAF3, IRF3, IRF7, and NF-kappa B . IFN-beta -deficient mice show increased susceptibility to experimental autoimmune encephalomyelitis (EAE), a disease model of human multiple sclerosis (MS) . Furthermore, IFN-beta has been shown to suppress the Th17 cell response in both MS and EAE and has commonly been used as a treatment for MS . IFN-beta can additionally induce the expression of the anti-inflammatory cytokine IL-10 .
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ile 22 -Asn 182
Route	No-tag
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	INYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size	19.73 kDa
Gene Symbol	Ifnb1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01883-20ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern