HADH2 (Hydroxyacyl-Coenzyme A Dehydrogenase Type II,AB-binding Alcohol Dehydrogenase,ABAD,CAMR,DUPXp11.22,ERAB,HCD2,HSD17B10,MHBD,Mitochondrial Ribonuclease P Protein 2,MRPP2,MRX17,MRX31,MRXS10,SCHAD,SDR5C1,Type II HADH,

Antibodies / Antibodies-Enzymes, Dehydrogenase

-20°C

Supplied as a liquid in PBS, pH 7.2.

Full length human HSD17B10, aa1-261 (NP_004484.1).

HCD2 (Hydroxyacyl-Coenzyme A dehydrogenase) is a mitochondrial protein that catalyzes the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. ERAB is characterized as a NAD+-dependent dehydrogenase that overexpressed in neurons affected with Alzheimer's disease.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.