Comparison

HADH2 (Hydroxyacyl-Coenzyme A Dehydrogenase Type II,AB-binding Alcohol Dehydrogenase,ABAD,CAMR,DUPXp11.22,ERAB,HCD2,HSD17B10,MHBD,Mitochondrial Ribonuclease P Protein 2,MRPP2,MRX17,MRX31,MRXS10,SCHAD,SDR5C1,Type II HADH,

Item no. USB-127709
Manufacturer United States Biological
Amount 100 ug
Category
Type Antibody Polyclonal
Format Liquid
Applications WB
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Pab
Manufacturer - Category
Antibodies / Antibodies-Enzymes, Dehydrogenase
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2.
EU Commodity Code
30021010
Immunogen
Full length human HSD17B10, aa1-261 (NP_004484.1).
Specificity
Recognizes human HSD17B10.
Description
HCD2 (Hydroxyacyl-Coenzyme A dehydrogenase) is a mitochondrial protein that catalyzes the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. ERAB is characterized as a NAD+-dependent dehydrogenase that overexpressed in neurons affected with Alzheimer's disease.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Manufacturer - Full Name
HADH2 (Hydroxyacyl-Coenzyme A Dehydrogenase Type II, AB-binding Alcohol Dehydrogenase, ABAD, CAMR, DUPXp11.22, ERAB, HCD2, HSD17B10, MHBD, Mitochondrial Ribonuclease P Protein 2, MRPP2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1, Type II HADH, Type 10 17b-H

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close