Vergleich

Neurofibromin (NF1, WSS, NFNS, VRNF, NF, Neurofibromin 1, Neurofibromatosis, Type I, von Recklinghausen Disease Neurofibromin, Neurofibromatosis-Noonan Syndrome, WATS, Watson Syndrome)

ArtNr USB-130308
Hersteller United States Biological
Menge 100 ug
Kategorie
Typ Antibody Monoclonal
Format Liquid
Applikationen WB, ELISA
Clon 2D1
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Cancer Markers
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2.
EU Commodity Code
30021010
Immunogen
Partial recombinant corresponding to aa2719-2818 from human NF1 (NP_000258) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human NF1.
Description
NF1 contains a GTPase-activating protein-related domain (GRD), and is involved in the negative regulation of Ras proteins, by accelerating the hydrolysis of active Ras-guanosine triphosphate. Mutations of NF1 have been reported in Neurofibromatosis type 1, which is characterized by a predisposition to a variety of tumors of the peripheral and central nervous systems as well as myeloid leukemia, cognitive deficits, bone deformations, and pigmentation defects.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen