Comparison

Neurofibromin (NF1, WSS, NFNS, VRNF, NF, Neurofibromin 1, Neurofibromatosis, Type I, von Recklinghausen Disease Neurofibromin, Neurofibromatosis-Noonan Syndrome, WATS, Watson Syndrome)

Item no. USB-130308
Manufacturer United States Biological
Amount 100 ug
Category
Type Antibody Monoclonal
Format Liquid
Applications WB, ELISA
Clone 2D1
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Shipping Condition Cool pack
Available
Manufacturer - Type
Mab
Manufacturer - Category
Antibodies / Antibodies-Cancer Markers
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2.
EU Commodity Code
30021010
Immunogen
Partial recombinant corresponding to aa2719-2818 from human NF1 (NP_000258) with GST tag. MW of the GST tag alone is 26kD.
Specificity
Recognizes human NF1.
Description
NF1 contains a GTPase-activating protein-related domain (GRD), and is involved in the negative regulation of Ras proteins, by accelerating the hydrolysis of active Ras-guanosine triphosphate. Mutations of NF1 have been reported in Neurofibromatosis type 1, which is characterized by a predisposition to a variety of tumors of the peripheral and central nervous systems as well as myeloid leukemia, cognitive deficits, bone deformations, and pigmentation defects.

Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
DTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQVQKQRSAGSFKRNSIKKIV

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close