Vergleich

SNRPA1 (U2 Small Nuclear Ribonucleoprotein A', U2 snRNP A')

ArtNr USB-133636
Hersteller United States Biological
Menge 50 ug
Kategorie
Typ Antibody Polyclonal
Format Liquid
Applikationen WB
Specific against Human (Homo sapiens)
Host Mouse
Isotype IgG
Purity Purified by Protein A affinity chromatography.
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Type
Pab
Manufacturer - Category
Antibodies / Antibodies-Nuclear Proteins
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Affinity Purified
Form
Supplied as a liquid in PBS, pH 7.2.
EU Commodity Code
30021010
Immunogen
Full length human SNRPA1, aa1-255 (NP_003081).
Specificity
Recognizes human SNRPA1.
Description
SNRPA1, a 28kD protein, is a specific component of U2 snRNP particle and consists of a unique N-terminal leucine-rich region and an extremely hydrophobic RNA-binding C-terminal region. It lacks segments homologous to RNP1 and RNP2, common aa motifs found in several RNA-binding proteins. It associates with U2 snRNP and participates in transcription and pre-mRNA splicing. It might play an important role in cell division and proliferation. Patients with connective tissue disorders often produce autoantibodies against snRNP particles.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen