SNRPA1 (U2 Small Nuclear Ribonucleoprotein A', U2 snRNP A')

Antibodies / Antibodies-Nuclear Proteins

-20°C

Supplied as a liquid in PBS, pH 7.2.

Full length human SNRPA1, aa1-255 (NP_003081).

SNRPA1, a 28kD protein, is a specific component of U2 snRNP particle and consists of a unique N-terminal leucine-rich region and an extremely hydrophobic RNA-binding C-terminal region. It lacks segments homologous to RNP1 and RNP2, common aa motifs found in several RNA-binding proteins. It associates with U2 snRNP and participates in transcription and pre-mRNA splicing. It might play an important role in cell division and proliferation. Patients with connective tissue disorders often produce autoantibodies against snRNP particles.

Applications:
Suitable for use in Western Blot. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

AA Sequence:
MVKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLDQALPCLTELILTNNSLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.