Vergleich

Heregulin beta-1, Recombinant, Human

ArtNr USB-143361
Hersteller United States Biological
Menge 10 ug
Quantity options 10 ug 50 ug
Kategorie
Typ Cytokines and Growth Factors
Format Lyophilized
Specific against other
Purity ≥98% (SDS-PAGE gel, HPLC). Endotoxin: ≤0.1ng/ug (≤1EU/ug).
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Molecular Biology / MB-Growth Factors-Heregulin
Shipping Temperature
Blue Ice
Storage Conditions
-20°C
Grade
Highly Purified
Form
Supplied as a lyophilized powder. Reconstitute with sterile dH2O, 0.1% BSA or HSA to 0.1-1mg/ml.
EU Commodity Code
30021019
Description
Neuregulin/Heregulin is a family of structurally related polypeptide growth factors derived from alternatively spliced genes (NRG1, NRG2, NRG3 and NRG4). To date, there are over 14 soluble and transmembrane proteins derived from the NRG1 gene. Proteolytic processing of the extracellular domain of the transmembrane NRG1 isoforms release soluble growth factors. HRG1-b1 contains an Ig domain and an EGF-like domain that is necessary for direct binding to receptor tyrosine kinases erb3 and erb4. This binding induces erb3 and erb4 heterodimerization with erb2, stimulating intrinsic kinase activity, which leads to tyrosine phosphorylation. Although HRG1-b1 biological effects is still unclear, it has been found to promote motility and invasiveness of breast cancer cells which may also involve up-regulation of expression and function of the autocrine motility-promoting factor (AMF). Recombinant human Heregulin-b1 (HRG1-b1) is a 7.5kD polypeptide consisting of only the EGF domain of heregulin-b1 (65aa residues).

Recombinant protein corresponding to human Heregulin beta-1, expressed in E. coli

Biological Activity:
The ED50, determined by the dose-dependent stimulation of the proliferation of human MCF-7 cells is <0.5ng/ml.

Specific Activity:
>2x10e6units/mg

Amino Acid Sequence:
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Shelf Life
1 year

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen