Beta-mammal Toxin Css4, Recombinant, Centruroides Suffusus Suffusu, aa20-85, His-SUMO-Tag

Blue Ice

23, 61

Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.

Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin is active only on mammals.

Source:
Partial recombinant protein corresponding to aa20-85 from centruroides suffusus suffusus Beta-mammal toxin Css4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli.

Molecular Weight:
~23.61kD

Amino Acid Sequence:
KEGYLVNSYTGCKFECFKLGDNDYCLRECRQQYGKGSGGYCYAFGCWCTHLYEQAVVWPLPNKTCN

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.