RAB5A Rabbit mAb

ArtNr	A12304-20ul
Hersteller	Abclonal
Menge	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Cell Biology Cytoskeleton Western Blot Primary Antibodies small GTPases Rab Subfamily
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
NCBI	RAB5A
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	RAB5,RAB5A
Similar products	RAB5
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	24kDa
Background	Enables GDP binding activity; GTP binding activity; and GTPase activity. Involved in several processes, including amyloid-beta clearance by transcytosis; early endosome to late endosome transport; and regulation of exocytosis. Located in several cellular components, including cytoplasmic side of early endosome membrane; nucleoplasm; and terminal bouton.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 116-215 of human RAB5AA (P20339).
Recommended Dilution	WB, 1:500 - 1:1000
Protein Size	24kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Signal transduction, Neuroscience, Cell type marker, Neurodegenerative diseases, Neuron marker, Synapse marker.
Antigen Seq	KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Manufacturer - Gene ID (Human)	5868
Expected Protein Size	24kDa
Gene Symbol	RAB5A

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A12304-20ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ul

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern