LC3B Mouse mAb

ArtNr	A17424-100ul
Hersteller	Abclonal
Menge	100 ul
Quantity options	1000 uL 100 ul 200 uL 20 ul 500 uL 50 ul
Kategorie	Neuroscience Neural Lineage Markers Protein Aggregation, Clearance & Misfolding Antibodies Cell Biology Cell Status Western Blot ELISA Immunofluorescence Autophagy Primary Antibodies Immunostaining Astroglia Markers
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Mouse
Isotype	IgG2a
Purity	Affinity purification
Sequence	MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
NCBI	MAP1LC3B
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	LC3B,ATG8F,MAP1LC3B-a,MAP1A/1BLC3
Similar products	MAP1LC3B, LC3B, ATG8F, MAP1A/1BLC3, MAP1LC3B-a, LC3A/LC3B
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Protein Weight	15kDa
Background	The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LC3B (NP_073729.1).
Recommended Dilution	WB, 1:500 - 1:2000\|IF/ICC, 1:50 - 1:100
Protein Size	15kDa
Route	Recombinant protein
Manufacturer - Research Area	Cancer, Signal Transduction, Cell Biology Developmental Biology, Autophagy, Cytoskeleton, Microtubules, Endocrine Metabolism, Mitochondrial metabolism, Neuroscience, Cardiovascular, Heart.
Antigen Seq	MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Manufacturer - Gene ID (Human)	81631
Expected Protein Size	15kDa
Gene Symbol	MAP1LC3B

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A17424-100ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 06.11.2025