BTK Rabbit mAb

ArtNr	A19002-200ul
Hersteller	Abclonal
Menge	200 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Oncology Antibodies By Cell Type Hematology Leukemia Lymphoma Immunohistochemistry Western Blot Immunofluorescence Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, IF, ICC, ELISA, IHC-P
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	PVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
NCBI	BTK
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	AT,ATK,BPK,XLA,IMD1,AGMX1,IGHD3,PSCTK1,BTK
Similar products	BTK, AGMX1, ATK, BPK, AT, IMD1, PSCTK1, XLA
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight	76kDa
Background	The protein encoded by this gene plays a crucial role in B-cell development. Mutations in this gene cause X-linked agammaglobulinemia type 1, which is an immunodeficiency characterized by the failure to produce mature B lymphocytes, and associated with a failure of Ig heavy chain rearrangement. Alternative splicing results in multiple transcript variants encoding different isoforms.
Manufacturer - Cross Reactivity	Human, Mouse
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 560-659 of human BTK (Q06187).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:50 - 1:200\|IF/ICC, 1:50 - 1:200
Protein Size	76kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Protein phosphorylation, Signal Transduction, Kinase, Tyrosine kinases, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, B Cell Receptor Signaling Pathway, Toll-like Receptor Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway, TLR Signaling.
Antigen Seq	PVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYERFTNSETAEHIAQGLRLYRPHLASEKVYTIMYSCWHEKADERPTFKILLSNILDVMDEES
Manufacturer - Gene ID (Human)	695
Expected Protein Size	76kDa
Gene Symbol	BTK

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A19002-200ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ul

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern