Vergleich

MonoMethyl-Histone H3-R2 Rabbit mAb Europäischer Partner

ArtNr A19645-100ul
Hersteller Abclonal
Menge 100ul
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA, Dot
Specific against Human
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY
NCBI Histone H3
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias H3/A;H3C2;H3C3;H3C4;H3C6;H3C7;H3C8;H3FA;H3C10;H3C11;H3C12;HIST1H3A
Similar products HIST1H3A, H3FA, H3C2, H3/A, H3C3, H3C4, H3C6, H3C7, H3C8, H3C10, H3C11, H3C12
Lieferbar
Background
This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.
Route
Synthetic Peptide
Manufacturers Category
Methylated Antibodies
Immunogen
A synthetic monomethylated peptide around R2 of human Histone H3 (Q16695).
Storage
Store at -20℃. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Recommended Dilution
DB, 1:500 - 1:1000|WB, 1:500 - 1:1000|CUT&Tag, 10⁵ cells /1 μg
Protein Size
16kDa
Gene Symbol
Histone H3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen