PPARγ Rabbit mAb

ArtNr	A19676-100ul
Hersteller	Abclonal
Menge	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Oncology Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Antibodies By Cell Type Carcinoma Western Blot Cardiovascular Research Atherosclerosis Primary Antibodies Other Lipid\Cholesterol Metabolism Modulators
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
NCBI	PPARG
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	GLM1, CIMT1, NR1C3, PPARG1, PPARG2, PPARG5, PPARgamma, PPARγ
Similar products	PPARgamma, PPARG, PPAR gamma, NR1C3, CIMT1, GLM1, PPARG1, PPARG2
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background	This gene encodes a member of the peroxisome proliferator-activated receptor (PPAR) subfamily of nuclear receptors. PPARs form heterodimers with retinoid X receptors (RXRs) and these heterodimers regulate transcription of various genes. Three subtypes of PPARs are known: PPAR-alpha, PPAR-delta, and PPAR-gamma. The protein encoded by this gene is PPAR-gamma and is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer. Alternatively spliced transcript variants that encode different isoforms have been described.
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PPARγ (P37231).
Recommended Dilution	WB, 1:500 - 1:2000
Protein Size	58kDa
Route	Synthetic Peptide
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Nuclear Receptor Signaling, Signal Transduction, mTOR Signaling Pathway, MAPK-Erk Signaling Pathway, Cell Biology Developmental Biology, Endocrine Metabolism, Lipid Metabolism, Endocrine and metabolic diseases, Obesity, Neuroscience, Neurodegenerative Diseases, Stem Cells, Mesenchymal Stem Cells

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A19676-100ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 14.08.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern