IFIT3 Rabbit pAb

ArtNr	A3924-100ul
Hersteller	Abclonal
Menge	100 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Oncology Antibodies Immunoprecipitation Western Blot Primary Antibodies By Organ Lung Cancer
Typ	Antibody Polyclonal
Applikationen	WB, ELISA, IHC-P
Specific against	Mouse (Murine, Mus musculus)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	ANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAMELNPQNQYLKVLLALKLLRMGEEAEGERLIKDALGKAPNQTDVLQKAAQFYKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQLQNKGDADSSERRQRMAELRRLTMEFMQKTLQRRRSPLNS
NCBI	Ifit3
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	P49,Ifi49,IFIT3
Similar products	IFIT3
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Protein Weight	56kDa
Background	Predicted to enable RNA binding activity and identical protein binding activity. Acts upstream of or within cellular response to interferon-beta; response to bacterium; and response to stilbenoid. Predicted to be located in mitochondrion. Predicted to be active in cytosol. Is expressed in alimentary system; eye; face; and nervous system. Orthologous to human IFIT3 (interferon induced protein with tetratricopeptide repeats 3).
Manufacturer - Cross Reactivity	Human, Mouse, Rat
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 128-331 of mouse IFIT3 (NP_034631.1).
Recommended Dilution	WB, 1:500 - 1:1000\|IHC-P, 1:100 - 1:200
Protein Size	56kDa
Route	Recombinant protein
Manufacturer - Research Area	Immunology & Inflammation, Cytokines, Interferons, Cell Intrinsic Innate Immunity Signaling Pathway.
Antigen Seq	ANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAMELNPQNQYLKVLLALKLLRMGEEAEGERLIKDALGKAPNQTDVLQKAAQFYKKKGNLDRAIELLGKALRSTVNNSPLYSLVMCRYREILEQLQNKGDADSSERRQRMAELRRLTMEFMQKTLQRRRSPLNS
Manufacturer - Gene ID (Human)	3437
Expected Protein Size	56kDa
Gene Symbol	Ifit3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A3924-100ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ul

lieferbar

Lieferung vsl. bis 09.10.2025