« Zurück
Startseite /
Recombinant Human Bcl-2 Protein

Recombinant Human Bcl-2 Protein

ArtNr	RP00062-100ug
Hersteller	Abclonal
Menge	100 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Kategorie	Oncology By Cell Type Blastoma Carcinoma Hematology Leukemia Lymphoma Myeloma Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Apoptosis Autophagy By Organ Colorectal Cancer Testicular & Prostate Cancer
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 90% by SDS-PAGE.
Dry ice	Yes
Sequence	AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
NCBI	Bcl-2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	BCL2,Bcl-2,PPP1R50,apoptosis regulator Bcl-2,Bcl-2,PPP1R50
Similar products	Bcl-2, PPP1R50
Versandbedingung	Trockeneis
Lieferbar
Manufacturer - Applications	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	dry ice
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	23.18 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human Bcl-2 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala2-Asp211) of human BCL2 (Accession #NP_000624.2) fused with no tags.
Background	This protein is an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Ala2-Asp211
Route	No tag
Endotoxin	< 1.0 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Other Recombinant Protein
Antigen Seq	AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Human BCL-XL Protein at 2 μg/mL (100 μL/well) can bind BCL2 (Catalog: RP00062) with a linear range of1. 95-126. 76ng/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of 20mM HEPES, 50mM KCl, pH 7.5.Contact us for customized product form or formulation.
Expected Protein Size	23.18 kDa
Gene Symbol	Bcl-2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00062-100ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern