« Zurück
Startseite /
Recombinant Human Biglycan/BGN Protein

Recombinant Human Biglycan/BGN Protein

ArtNr	RP00141-100ug
Hersteller	Abclonal
Menge	100 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Kategorie	Neuroscience Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins Cell Biology Cytoskeleton small GTPases Ras Subfamily
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 80% by SDS-PAGE.
Sequence	DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARV
NCBI	Biglycan/BGN
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	BGN,DSPG1,MRLS,PG-S1,PGI,SEMDX,SLRR1A,biglycan
Similar products	PGI, DSPG1, PG-S1, SLRR1A
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	38.08 kDa
Manufacturer - Additional Information	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human Biglycan/BGN Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Asp38-Lys368) of human Biglycan/BGN (Accession #NP_001702.1) fused with a 6×His tag at the C-terminus.
Background	Biglycan, also known as PG I, is a secreted chondroitin/dermatan sulfate proteoglycan in the small leucine-rich proteoglycan (SLRP) family.The protein is plays a role in bone growth, muscle development and regeneration, and collagen fibril assembly in multiple tissues. This protein may also regulate inflammation and innate immunity. Additionally, It may contribute to atherosclerosis and aortic valve stenosis in human patients.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Asp38-Lys368
Route	C-His
Endotoxin	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Other Recombinant Protein
Antigen Seq	DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	38.08 kDa
Gene Symbol	Biglycan/BGN

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00141-100ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern