Vergleich

Recombinant Human uPA/PLAU Protein Europäischer Partner

ArtNr RP00146LQ-50ug
Hersteller Abclonal
Menge 50 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 500 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 97% by SDS-PAGE.
Dry ice Yes
Sequence MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE
NCBI uPA/PLAU
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PLAU,ATF,BDPLT5,QPD,UPA,URK,u-PA,urokinase
Similar products ATF, UPA, URK, u-PA, BDPLT5, QPD
Versandbedingung Trockeneis
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
dry ice
Storage Conditions
Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight
49.36 kDa
Description
Recombinant Human uPA/PLAU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Leu431) of human Urokinase/PLAU (Accession #NP_002649.1) fused with a 8×His tag at the C-terminus.
Background
Plasminogen activator, urokinase, also known as PLAU and uPA, is a serine protease which converts plasminogen to plasmin, a broad-spectrum protease active on extracellular matrix (ECM) components. It is involved in complement activation, cell migration, wound healing, and generation of localized extracellular proteolysis during tissue remodelling, pro-hormone conversion, carcinogenesis and neoplasia. uPA and its receptor (uPAR) have been implicated in a broad spectrum of pathophysiological processes, including fibrinolysis, proteolysis, inflammation, atherogenesis and plaque destabilization, all of which are involved in the pathogenesis of MI (myocardial infarction). The role of uPA is not only does it as a kind of enzyme, but also is breast cancer, stomach cancer, colon cancer, bladder cancer, ovarian cancer, brain, and endometrial cancer markers for a strong invasion and metastasis.Because of the causal involvment of uPA in cancer invasion and metastasis, the blockade of uPA interactions and activity with specific inhibitors is of interest for novel strategies in cancer therapy.
Immunogen
Met1-Leu431
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Other Recombinant Protein
Antigen Seq
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human uPAR Protein at 1 μg/mL (100 μL/well) can bind PLAU with a linear range of 0. 031-1. 014 ng/mL.
Protein Formulation
Supplied as a 0.22 μm filtered solution in 20mM HEPES, 150mM NaCl, 2mM CaCl, 10% Glycerol, pH 7.5Contact us for customized product form or formulation.
Expected Protein Size
49.36 kDa
Gene Symbol
uPA/PLAU

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen