Comparison

Recombinant Human uPA/PLAU Protein European Partner

Item no. RP00146LQ-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 500 ug 50 ug 5 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 97% by SDS-PAGE.
Dry ice Yes
Sequence MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFE
NCBI uPA/PLAU
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PLAU,ATF,BDPLT5,QPD,UPA,URK,u-PA,urokinase
Similar products ATF, UPA, URK, u-PA, BDPLT5, QPD
Shipping Condition Dry ice
Available
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
dry ice
Storage Conditions
Store at -70°C. This product is stable at ≤ -70°C for up to 1 year from the date of receipt. For optimal storage, aliquot into smaller quantities after centrifugation and store at recommended temperature. Avoid repeated freeze-thaw cycles.
Protein Weight
49.36 kDa
Description
Recombinant Human uPA/PLAU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Leu431) of human Urokinase/PLAU (Accession #NP_002649.1) fused with a 8×His tag at the C-terminus.
Background
Plasminogen activator, urokinase, also known as PLAU and uPA, is a serine protease which converts plasminogen to plasmin, a broad-spectrum protease active on extracellular matrix (ECM) components. It is involved in complement activation, cell migration, wound healing, and generation of localized extracellular proteolysis during tissue remodelling, pro-hormone conversion, carcinogenesis and neoplasia. uPA and its receptor (uPAR) have been implicated in a broad spectrum of pathophysiological processes, including fibrinolysis, proteolysis, inflammation, atherogenesis and plaque destabilization, all of which are involved in the pathogenesis of MI (myocardial infarction). The role of uPA is not only does it as a kind of enzyme, but also is breast cancer, stomach cancer, colon cancer, bladder cancer, ovarian cancer, brain, and endometrial cancer markers for a strong invasion and metastasis.Because of the causal involvment of uPA in cancer invasion and metastasis, the blockade of uPA interactions and activity with specific inhibitors is of interest for novel strategies in cancer therapy.
Immunogen
Met1-Leu431
Route
C-His
Endotoxin
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Other Recombinant Protein
Antigen Seq
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human uPAR Protein at 1 μg/mL (100 μL/well) can bind PLAU with a linear range of 0. 031-1. 014 ng/mL.
Protein Formulation
Supplied as a 0.22 μm filtered solution in 20mM HEPES, 150mM NaCl, 2mM CaCl, 10% Glycerol, pH 7.5Contact us for customized product form or formulation.
Expected Protein Size
49.36 kDa
Gene Symbol
uPA/PLAU

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close