« Zurück
Startseite /
Recombinant Human IFN-lambda 3/IL-28B Protein

Recombinant Human IFN-lambda 3/IL-28B Protein

ArtNr	RP00219-200ug
Hersteller	Abclonal
Menge	200 ug
Quantity options	100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Kategorie	Neuroscience Neural Transcription Factors Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
NCBI	IFN-lambda 3/IL-28B
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	IFNL3,IFN-lambda-3,IFN-lambda-4,IL-28B,IL-28C,IL28B,IL28C
Similar products	IL28B, IL28C, IL-28B, IL-28C, IFN-lambda-3, IFN-lambda-4
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Applications	< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	23.39 kDa
Description	Recombinant Human IFN-lambda 3/IL-28B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Val196) of human IFNL3/IL28B/Interleukin-28B (Accession #NP_742151.2) fused with a 6×His tag at the C-terminus.
Background	Interleukin-28B (IL-28B) also known as Interferon lambda-3 and IFN-lambda-3, belongs to the type III interferon family of cytokines. IL-28B is a cytokine with immunomodulatory activity. It functions in Up-regulating MHC class I antigen expression. IL-28B displays potent antiviral activity and antitumor activity. This cytokine serves as ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. IL-28B is able to increase the percentage of splenic CD8+ T cells in vaccinated animals and have higher antigen-specific cytolytic .
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Met1-Val196
Route	C-His
Manufacturer - Research Area	Interleukin, Cytokines & Cytokine receptors
Revised name	IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C, IL-28B, IL28B, IL28C
Antigen Seq	MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Bioactivity	Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL28B at 2 μg/mL (100 μL/well) can bind Recombinant Human IL10RB with a linear range of 0. 25-1 μg/mL.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, 500mM NaCl, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size	23.39 kDa
Gene Symbol	IFN-lambda 3/IL-28B

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00219-200ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern