Vergleich

Recombinant Human IFN-lambda 3/IL-28B Protein Europäischer Partner

ArtNr RP00219-5ug
Hersteller Abclonal
Menge 5 ug
Quantity options 100 ug 10 ug 200 ug 20 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Human
Purity > 95% by SDS-PAGE.
NCBI IFN-lambda 3/IL-28B
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IFNL3,IFN-lambda-3,IFN-lambda-4,IL-28B,IL-28C,IL28B,IL28C
Similar products IL28B, IL28C, IL-28B, IL-28C, IFN-lambda-3, IFN-lambda-4
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
23.39 kDa
Description
Recombinant Human IFN-lambda 3/IL-28B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Val196) of human IFNL3/IL28B/Interleukin-28B (Accession #NP_742151.2) fused with a 6×His tag at the C-terminus.
Background
Interleukin-28B (IL-28B) also known as Interferon lambda-3 and IFN-lambda-3, belongs to the type III interferon family of cytokines. IL-28B is a cytokine with immunomodulatory activity. It functions in Up-regulating MHC class I antigen expression. IL-28B displays potent antiviral activity and antitumor activity. This cytokine serves as ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. IL-28B is able to increase the percentage of splenic CD8+ T cells in vaccinated animals and have higher antigen-specific cytolytic .
Immunogen
Met1-Val196
Route
C-His
Manufacturer - Research Area
Interleukin, Cytokines & Cytokine receptors
Revised name
IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C, IL-28B, IL28B, IL28C
Antigen Seq
MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human IL28B at 2 μg/mL (100 μL/well) can bind Recombinant Human IL10RB with a linear range of 0. 25-1 μg/mL.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, 500mM NaCl, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
23.39 kDa
Gene Symbol
IFN-lambda 3/IL-28B

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen