« Zurück
Startseite /
Recombinant Human R-spondin-3 Protein

Recombinant Human R-spondin-3 Protein

ArtNr	RP00439-10ug
Hersteller	Abclonal
Menge	10 ug
Quantity options	1000 ug 10 ug 500 ug 50 ug
Kategorie	Oncology Metabolism Diabetes Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Host	Human
Purity	> 95% by SDS-PAGE.
Sequence	QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
NCBI	R-spondin-3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RSPO3,CRISTIN1,PWTSR,THSD2
Similar products	CRISTIN1, PWTSR, THSD2
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Biosimilar Drug Targets
Shipping Temperature	ice pack
Storage Conditions	Store the lyophilized protein at -20°C to -80 °C for long term. After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Manufacturer - Additional Information	Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description	Recombinant Human R-spondin-3 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Gln22-His272) of human R-spondin-3/RSPO3 (Accession #Q9BXY4) fused with an Fc, 6xHis tag at the C-terminus.
Background	This protein belongs to the R-spondin family. The encoded protein plays a role in the regulation of Wnt (wingless-type MMTV integration site family)/beta-catenin and Wnt/planar cell polarity (PCP) signaling pathways, which are involved in development, cell growth and disease pathogenesis. Genome-wide association studies suggest a correlation of this gene with bone mineral density and risk of fracture. This gene may be involved in tumor development.
Immunogen	Gln22-His272
Route	C-Fc&His
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Biosimilar Drug Targets
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH7.2.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00439-10ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern